« Back
Home /
Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial

Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	100ug
Host	E.coli
Item no.	CSB-EP020067HU-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Neuroscience
Uniprot ID	Q01973
Gene Names	ROR1
Organism	Homo sapiens (Human)
AA Sequence	QETELSVSAELVPTSSWNISSELNKDSYLTLDEPM NNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVV QEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVAT NGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGF CQPYRGIACARFIGNRTVYMESLHMQGEIENQITA AFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETS SVPKPRDLCRDECEILENVLCQTEYIFARSNPMIL MRLKLPNCEDLPQPESPEAANCIRIGIPMADPINK NHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHT HTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDE NFKSDLCDIPAC
Expression Region	30-391aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	44.6 kDa
Alternative Name(s)	Neurotrophic tyrosine kinase, receptor-related 1
Relevance	Tyrosine-protein kinase receptor whose role is not yet clear.
Reference	Patterns of somatic mutation in human cancer genomes.Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.Nature 446:153-158(2007)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo
Involvement in disease	Deafness, autosomal recessive, 108 (DFNB108)
Subcellular Location	Membrane, Single-pass type I membrane protein, Cell projection, axon
Protein Families	Protein kinase superfamily, Tyr protein kinase family, ROR subfamily
Tissue Specificity	Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP020067HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time