Comparison

Recombinant Mouse 60S acidic ribosomal protein P0(Rplp0)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Lyophilized Powder
Amount 10ug
Host E.coli
Item no. CSB-EP020336MO-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
60S ribosomal protein L10E
AA Sequence
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNV GSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLE NNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLAN KVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQA LGITTKISRGTIEILSDVQLIKTGDKVGASEATLL NMLNISPFSFGLIIQQVFDNGSIYNPEVLDITEQA LHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGY KRVLALSVETEYTFPLTEKVKAFLADPSAFAAAAP AAAATTAAPAAAAAPAKAEAKEESEESDEDMGFGL FD
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P14869
Gene Names
Rplp0
Tag Info
N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region
1-317aa
MW of Fusion Proten
54, 2
Sequence Info
Full Length
Relevance
Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
Reference
"The mouse homologue of the human acidic ribosomal phosphoprotein PO: a highly conserved polypeptide that is under translational control."
Krowczynska A.M., Coutts M., Makrides S., Brawerman G.Nucleic Acids Res. 17:6408-6408(1989)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close