Comparison

Recombinant Mouse 60S acidic ribosomal protein P0(Rplp0)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Lyophilized Powder
Amount 10ug
Host E.coli
Item no. CSB-EP020336MO-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P14869
Gene Names
Rplp0
Organism
Mus musculus (Mouse)
AA Sequence
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNV GSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLE NNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLAN KVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQA LGITTKISRGTIEILSDVQLIKTGDKVGASEATLL NMLNISPFSFGLIIQQVFDNGSIYNPEVLDITEQA LHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGY KRVLALSVETEYTFPLTEKVKAFLADPSAFAAAAP AAAATTAAPAAAAAPAKAEAKEESEESDEDMGFGL FD
Expression Region
1-317aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
MW
54.2 kDa
Alternative Name
60S ribosomal protein L10E
Relevance
Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
Reference
"The mouse homologue of the human acidic ribosomal phosphoprotein PO: a highly conserved polypeptide that is under translational control."
Krowczynska A.M., Coutts M., Makrides S., Brawerman G.Nucleic Acids Res. 17:6408-6408(1989)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
Subcellular Location
Nucleus, Cytoplasm
Protein Families
Universal ribosomal protein uL10 family
Amount: 10ug
Available: In stock
Listprice: €230.66
Price: €230.66
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close