Comparison

Recombinant Human 40S ribosomal protein S27(RPS27)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP020419HU-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Metallopan-stimulin 1
AA Sequence
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVK CPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKA RLTEGCSFRRKQH
Research Topic
others
Uniprot ID
P42677
Gene Names
RPS27
Tag Info
N-terminal GST-tagged
Expression Region
1-84aa
MW of Fusion Proten
36, 3
Sequence Info
Full Length
Reference
"A growth factor-inducible gene encodes a novel nuclear protein with zinc finger structure."
Fernandez-Pol J.A., Klos D.J., Hamilton P.D.
J. Biol. Chem. 268:21198-21204(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 500ug
Available: In stock
Listprice: €1,272.85
Price: €1,272.85
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close