« Back
Home /
Recombinant Drosophila melanogaster 40S ribosomal protein S3(RpS3)

Recombinant Drosophila melanogaster 40S ribosomal protein S3(RpS3)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Item no.	CSB-EP020443DLU-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Others
Uniprot ID	Q06559
Gene Names	RpS3
Organism	Drosophila melanogaster (Fruit fly)
AA Sequence	MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDG YSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRE LTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAE SLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVV SGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATR HVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNV SVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKV
Expression Region	1-246aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	31.5 kDa
Alternative Name(s)	M(3)95A
Relevance	Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta, delta elimination reaction.
Reference	"A Drosophila ribosomal protein contains 8-oxoguanine and abasic site DNA repair activities." Yacoub A., Augeri L., Kelley M.R., Doetsch P.W., Deutsch W.A. EMBO J. 15:2306-2312(1996)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta, delta elimination reaction.
Subcellular Location	Cytoplasm, Nucleus
Protein Families	Universal ribosomal protein uS3 family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time