Recombinant Drosophila melanogaster 40S ribosomal protein S3(RpS3)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
ArtNr CSB-EP020443DLU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
Q06559
Gene Names
RpS3
Organism
Drosophila melanogaster (Fruit fly)
AA Sequence
MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDG YSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRE LTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAE SLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVV SGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATR HVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNV SVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKV
Expression Region
1-246aa
Sequence Info
Full Length
Tag Info
N-terminal 6xHis-tagged
MW
31.5 kDa
Alternative Name(s)
M(3)95A
Relevance
Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta, delta elimination reaction.
Reference
"A Drosophila ribosomal protein contains 8-oxoguanine and abasic site DNA repair activities."
Yacoub A., Augeri L., Kelley M.R., Doetsch P.W., Deutsch W.A.
EMBO J. 15:2306-2312(1996)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €282.14
Price: €282.14
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close