Comparison

Recombinant Human Ras-related protein R-Ras2(RRAS2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP020514HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Ras-like protein TC21
Teratocarcinoma oncogene
AA Sequence
AAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQ SYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAG QEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYK FQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEE GQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIR KFQEQECPPSPEPTRKEKDKKGCHC
Research Topic
Signal Transduction
Uniprot ID
P62070
Gene Names
RRAS2
Tag Info
N-terminal GST-tagged
Expression Region
1-204aa
MW of Fusion Proten
49, 9
Sequence Info
Full Length
Relevance
It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.
Reference
"Characterization of four novel ras-like genes expressed in a human teratocarcinoma cell line."
Drivas G.T., Shih A., Coutavas E., Rush M.G., D'Eustachio P.
Mol. Cell. Biol. 10:1793-1798(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close