Comparison

Recombinant Human Retinoschisin(RS1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP020534HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
X-linked juvenile retinoschisis protein
AA Sequence
STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLD CIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWY SSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLK EIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNW IYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRF IRLIPLGWHVRIAIRMELLECVSKCA
Research Topic
Cell Adhesion
Uniprot ID
O15537
Gene Names
RS1
Tag Info
N-terminal 6xHis-tagged
Expression Region
24-224aa
MW of Fusion Proten
27
Sequence Info
Full Length
Relevance
May be active in cell adhesion processes during retinal development.
Reference
Clinical and genetic findings in Hungarian patients with X-linked juvenile retinoschisis.Lesch B., Szabo V., Kanya M., Somfai G.M., Vamos R., Varsanyi B., Pamer Z., Knezy K., Salacz G., Janaky M., Ferencz M., Hargitai J., Papp A., Farkas A.Mol. Vis. 14:2321-2332(2008)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close