Recombinant Human Retinoschisin(RS1)

Cell Adhesion

Not Test

Homo sapiens (Human)

STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLD CIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWY SSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLK EIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNW IYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRF IRLIPLGWHVRIAIRMELLECVSKCA

24-224aa

27 kDa

X-linked juvenile retinoschisis protein

Clinical and genetic findings in Hungarian patients with X-linked juvenile retinoschisis.Lesch B., Szabo V., Kanya M., Somfai G.M., Vamos R., Varsanyi B., Pamer Z., Knezy K., Salacz G., Janaky M., Ferencz M., Hargitai J., Papp A., Farkas A.Mol. Vis. 14:2321-2332(2008)

Liquid or Lyophilized powder

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.

Retinoschisis juvenile X-linked 1 (XLRS1)

Restricted to the retina (at protein level) (PubMed:10915776). Detected in the inner segment of the photoreceptors, the inner nuclear layer, the inner plexiform layer and the ganglion cell layer (at protein level). At the macula, expressed in both the outer and inner nuclear layers and in the inner plexiform layer (at protein level) (PubMed:10915776). Detected in retina (PubMed:9326935). Detected only within the photoreceptor cell layer, most prominently within the inner segments of the photoreceptors (PubMed:10915776). Undetectable in the inner plexiform layers and the inner nuclear layer (PubMed:10915776).