Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
Format |
Liquid or Lyophilized powder |
Amount |
1mg |
Host |
E.coli |
Item no. |
CSB-EP020534HU-1 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Areas |
Cell Adhesion |
Target / Protein |
RS1 |
Biologically Active |
Not Test |
Expression System |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
O15537 |
AA Sequence |
STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLD CIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWY SSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLK EIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNW IYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRF IRLIPLGWHVRIAIRMELLECVSKCA |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
24-224aa |
Protein Length |
Full Length of Mature Protein |
MW |
27 kDa |
Distributor Discount |
50% off the list price |
Alternative Name(s) |
X-linked juvenile retinoschisis protein |
Relevance |
May be active in cell adhesion processes during retinal development. |
Reference |
Clinical and genetic findings in Hungarian patients with X-linked juvenile retinoschisis.Lesch B., Szabo V., Kanya M., Somfai G.M., Vamos R., Varsanyi B., Pamer Z., Knezy K., Salacz G., Janaky M., Ferencz M., Hargitai J., Papp A., Farkas A.Mol. Vis. 14:2321-2332(2008) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Binds negatively charged membrane lipids, such as phosphatidylserine and phosphoinositides (By similarity). May play a role in cell-cell adhesion processes in the retina, via homomeric interaction between octamers present on the surface of two neighboring cells |
Involvement in disease |
Retinoschisis juvenile X-linked 1 (XLRS1) |
Subcellular Location |
Secreted, Cell membrane, Peripheral membrane protein, Extracellular side |
Tissue Specificity |
Restricted to the retina (at protein level) (PubMed:10915776). Detected in the inner segment of the photoreceptors, the inner nuclear layer, the inner plexiform layer and the ganglion cell layer (at protein level). At the macula, expressed in both the outer and inner nuclear layers and in the inner plexiform layer (at protein level) (PubMed:10915776). Detected in retina (PubMed:9326935). Detected only within the photoreceptor cell layer, most prominently within the inner segments of the photoreceptors (PubMed:10915776). Undetectable in the inner plexiform layers and the inner nuclear layer (PubMed:10915776). |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.