Comparison

Recombinant Human Retinoschisin(RS1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP020534HU-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cell Adhesion
Uniprot ID
O15537
Gene Names
RS1
Organism
Homo sapiens (Human)
AA Sequence
STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLD CIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWY SSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLK EIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNW IYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRF IRLIPLGWHVRIAIRMELLECVSKCA
Expression Region
24-224aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
27 kDa
Alternative Name
X-linked juvenile retinoschisis protein
Relevance
May be active in cell adhesion processes during retinal development.
Reference
Clinical and genetic findings in Hungarian patients with X-linked juvenile retinoschisis.Lesch B., Szabo V., Kanya M., Somfai G.M., Vamos R., Varsanyi B., Pamer Z., Knezy K., Salacz G., Janaky M., Ferencz M., Hargitai J., Papp A., Farkas A.Mol. Vis. 14:2321-2332(2008)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Binds negatively charged membrane lipids, such as phosphatidylserine and phosphoinositides (By similarity). May play a role in cell-cell adhesion processes in the retina, via homomeric interaction between octamers present on the surface of two neighboring cells
Involvement in disease
Retinoschisis juvenile X-linked 1 (XLRS1)
Subcellular Location
Secreted, Cell membrane, Peripheral membrane protein, Extracellular side
Tissue Specificity
Restricted to the retina (at protein level) (PubMed:10915776). Detected in the inner segment of the photoreceptors, the inner nuclear layer, the inner plexiform layer and the ganglion cell layer (at protein level). At the macula, expressed in both the outer and inner nuclear layers and in the inner plexiform layer (at protein level) (PubMed:10915776). Detected in retina (PubMed:9326935). Detected only within the photoreceptor cell layer, most prominently within the inner segments of the photoreceptors (PubMed:10915776). Undetectable in the inner plexiform layers and the inner nuclear layer (PubMed:10915776).
Amount: 1mg
Available: In stock
Listprice: €1,552.27
Price: €1,552.27
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close