Comparison

Recombinant Human Runt-related transcription factor 3(RUNX3)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP020595HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Acute myeloid leukemia 2 protein
Core-binding factor subunit alpha-3
Short name:CBF-alpha-3
AA Sequence
MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGA LSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTD SPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGT VVTVMAGNDENYSAELRNASAVMKNQVARFNDLRF VGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVD GPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTP STPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDP RQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPY SATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGA PQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSS SGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQS DGVEADGSHSNSPTALSTPGRMDEAVWRPY
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q13761
Gene Names
RUNX3
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region
1-415aa
MW of Fusion Proten
49, 4
Sequence Info
Full Length
Relevance
CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, lck, IL-3 and GM-CSF promoters. In association with ZFHX3, upregulates CDKN1A promoter activity following TGF-beta stimulation (PubMed:20599712).
Reference
"AML1, AML2, and AML3, the human members of the runt domain gene-family: cDNA structure, expression, and chromosomal localization."Levanon D., Negreanu V., Bernstein Y., Bar-Am I., Avivi L., Groner Y.Genomics 23:425-432(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close