Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-EP020595HU-200 |
Conjugate/Tag |
Myc |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
Q13761 |
Gene Names |
RUNX3 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGA LSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTD SPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGT VVTVMAGNDENYSAELRNASAVMKNQVARFNDLRF VGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVD GPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTP STPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDP RQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPY SATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGA PQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSS SGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQS DGVEADGSHSNSPTALSTPGRMDEAVWRPY |
Expression Region |
1-415aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
MW |
49.4 kDa |
Alternative Name(s) |
Acute myeloid leukemia 2 protein Core-binding factor subunit alpha-3 Short name:CBF-alpha-3 |
Relevance |
CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, lck, IL-3 and GM-CSF promoters. In association with ZFHX3, upregulates CDKN1A promoter activity following TGF-beta stimulation (PubMed:20599712). |
Reference |
"AML1, AML2, and AML3, the human members of the runt domain gene-family: cDNA structure, expression, and chromosomal localization."Levanon D., Negreanu V., Bernstein Y., Bar-Am I., Avivi L., Groner Y.Genomics 23:425-432(1994) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, lck, IL-3 and GM-CSF promoters. In association with ZFHX3, upregulates CDKN1A promoter activity following TGF-beta stimulation |
Subcellular Location |
Nucleus, Cytoplasm |
Tissue Specificity |
Expressed in gastric cancer tissues (at protein level). |
Paythway |
Th1andTh2celldifferentiation |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.