Comparison

Recombinant Human Ryanodine receptor 1(RYR1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP020619HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Skeletal muscle calcium release channelSkeletal muscle ryanodine receptorSkeletal muscle-type ryanodine receptorType 1 ryanodine receptor
AA Sequence
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLC LAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQ SLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHA ILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDA TGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSS ERYLHLSTASGELQVDASFMQTLWNMNPICSRCEE GFVTGGHVLRLFHGHMDECLTISPADSDDQRRLVY YEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLR VRHVTTGQYLALTEDQGLVVVDASKAHTKATSFCF RISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHV ASGLWLTYAAPDPKALRLGVLKKKAMLHQEGHMDD ALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSF SGKPRGSGPPAGTALPIEGVILSLQDLIIYFEPPS EDLQHEEKQSKLRSLRNRQSLFQEEGMLSMVLNCI DRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELL ASLIRGNRS
Research Topic
Transport
Uniprot ID
P21817
Gene Names
RYR1
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-534aa
MW of Fusion Proten
63, 3
Sequence Info
Partial
Relevance
Calcium channel that mediates the release of Ca2+ from the sarcoplasmic reticulum into the cytoplasm and thereby plays a key role in triggering muscle contraction following depolarization of T-tubules. Repeated very high-level exercise increases the open probability of the channel and leads to Ca2+ leaking into the cytoplasm. Can also mediate the release of Ca2+ from intracellular stores in neurons, and may thereby promote prolonged Ca2+ signaling in the brain. Required for normal bryonic development of muscle fibers and skeletal muscle. Required for normal heart morphogenesis, skin development and ossification during bryogenesis .
Reference
Samaritan myopathy, an ultimately benign congenital myopathy, is caused by a RYR1 mutation.Bohm J., Leshinsky-Silver E., Vassilopoulos S., Le Gras S., Lerman-Sagie T., Ginzberg M., Jost B., Lev D., Laporte J.Acta Neuropathol. 124:575-581(2012)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close