Comparison

Recombinant Human Protein S100-A11(S100A11)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP020624HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Calgizzarin; Metastatic lymph node gene 70 protein ; MLN 70Protein S100-CS100 calcium-binding protein A11
AA Sequence
AKISSPTETERCIESLIAVFQKYAGKDGYNYTLSK TEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNS DGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Research Topic
Signal Transduction
Uniprot ID
P31949
Gene Names
S100A11
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-105aa
MW of Fusion Proten
27, 6
Sequence Info
Full Length
Relevance
Facilitates the differentiation and the cornification of keratinocytes.
Reference
Human calgizzarin; one colorectal cancer-related gene selected by a large scale random cDNA sequencing and northern blot analysis.Tanaka M., Adzuma K., Iwami M., Yoshimoto K., Monden Y., Itakura M.Cancer Lett. 89:195-200(1995)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close