Comparison

Recombinant Human Protein S100-A3(S100A3)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP020631HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Protein S-100E
S100 calcium-binding protein A3
AA Sequence
ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKE LLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVD FVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
Research Topic
Signal Transduction
Uniprot ID
P33764
Gene Names
S100A3
Tag Info
N-terminal GST-tagged
Expression Region
1-101aa
MW of Fusion Proten
38, 6
Sequence Info
Full Length
Relevance
Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.
Reference
"Six S100 genes are clustered on human chromosome 1q21: identification of two genes coding for the two previously unreported calcium-binding proteins S100D and S100E."
Engelkamp D., Schaefer B.W., Mattei M.-G., Erne P., Heizmann C.W.
Proc. Natl. Acad. Sci. U.S.A. 90:6547-6551(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close