« Back
Home /
Recombinant Human Protein S100-A3(S100A3)

Recombinant Human Protein S100-A3(S100A3)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-EP020631HU-200
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	P33764
Gene Names	S100A3
Organism	Homo sapiens (Human)
AA Sequence	ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKE LLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVD FVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
Expression Region	1-101aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	38.6 kDa
Alternative Name(s)	Protein S-100E S100 calcium-binding protein A3
Relevance	Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.
Reference	"Six S100 genes are clustered on human chromosome 1q21: identification of two genes coding for the two previously unreported calcium-binding proteins S100D and S100E." Engelkamp D., Schaefer B.W., Mattei M.-G., Erne P., Heizmann C.W. Proc. Natl. Acad. Sci. U.S.A. 90:6547-6551(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.
Subcellular Location	Cytoplasm
Protein Families	S-100 family
Tissue Specificity	Skin specific, specifically expressed at the inner endocuticle of hair fibers.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP020631HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time