Comparison

Recombinant Human Protein S100-A4(S100A4)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP020632HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cardiovascular
Uniprot ID
P26447
Gene Names
S100A4
Organism
Homo sapiens (Human)
AA Sequence
ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKE LLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVD FQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Expression Region
2-101aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
27.6 kDa
Alternative Name
Calvasculin. Metastasin. Placental calcium-binding protein. Protein Mts1S100 calcium-binding protein A4
Reference
Transcriptional analysis of the mts1 gene with specific reference to 5' flanking sequences.Tulchinsky E.M., Ford H.L., Kramerov D., Reshetnyak E., Grigorian M., Zain S., Lukanidin E.Proc. Natl. Acad. Sci. U.S.A. 89:9146-9150(1992)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Protein Families
S-100 family
Tissue Specificity
Ubiquitously expressed.
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close