Comparison

Recombinant Human Protein S100-A4(S100A4)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP020632HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Calvasculin; Metastasin; Placental calcium-binding protein; Protein Mts1S100 calcium-binding protein A4
AA Sequence
ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKE LLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVD FQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Research Topic
Cardiovascular
Uniprot ID
P26447
Gene Names
S100A4
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-101aa
MW of Fusion Proten
27, 6
Sequence Info
Full Length
Reference
Transcriptional analysis of the mts1 gene with specific reference to 5' flanking sequences.Tulchinsky E.M., Ford H.L., Kramerov D., Reshetnyak E., Grigorian M., Zain S., Lukanidin E.Proc. Natl. Acad. Sci. U.S.A. 89:9146-9150(1992)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close