Comparison

Recombinant Human Protein S100-A6(S100A6)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP020634HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Calcyclin; Growth factor-inducible protein 2A9MLN 4Prolactin receptor-associated protein ; PRAS100 calcium-binding protein A6
AA Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELK ELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNF QEYVTFLGALALIYNEALKG
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P06703
Gene Names
S100A6
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-90aa
MW of Fusion Proten
26, 2
Sequence Info
Full Length
Relevance
May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
Reference
Molecular cloning of the cDNA for a growth factor-inducible gene with strong homology to S-100, a calcium-binding protein.Calabretta B., Battini R., Kaczmarek L., de Riel J.K., Baserga R.J. Biol. Chem. 261:12628-12632(1986)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close