Comparison

Recombinant Artemisia vulgaris Non-specific lipid-transfer protein

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Item no. CSB-EP020856AOH-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P0C088
Gene Names
N/A
Organism
Artemisia vulgaris (Mugwort)
AA Sequence
ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGL ND
Expression Region
1-37aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
NO-Tagged
MW
3.8 kDa
Alternative Name
Pollen allergen Art v 3
Allergen: Art v 3
Relevance
Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues
Reference
"Lipid-transfer proteins as potential plant panallergens: cross-reactivity among proteins of Artemisia pollen, Castanea nut and Rosaceae fruits, with different IgE-binding capacities."
Diaz-Perales A., Lombardero M., Sanchez-Monge R., Garcia-Selles F.J., Pernas M., Fernandez-Rivas M., Barber D., Salcedo G.
Clin. Exp. Allergy 30:1403-1410(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €364.57
Price: €364.57
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close