« Back
Home /
Recombinant Artemisia vulgaris Non-specific lipid-transfer protein,partial

Recombinant Artemisia vulgaris Non-specific lipid-transfer protein,partial

Manufacturer	Cusabio
Category	Metabolism Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Item no.	CSB-EP020856AOH-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Others
Uniprot ID	P0C088
Gene Names	N/A
Organism	Artemisia vulgaris (Mugwort)
AA Sequence	ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGL ND
Expression Region	1-37aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	Tag-Free
MW	3.8 kDa
Alternative Name(s)	Pollen allergen Art v 3 Allergen: Art v 3
Relevance	Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues
Reference	"Lipid-transfer proteins as potential plant panallergens: cross-reactivity among proteins of Artemisia pollen, Castanea nut and Rosaceae fruits, with different IgE-binding capacities." Diaz-Perales A., Lombardero M., Sanchez-Monge R., Garcia-Selles F.J., Pernas M., Fernandez-Rivas M., Barber D., Salcedo G. Clin. Exp. Allergy 30:1403-1410(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).
Protein Families	Plant LTP family
Tag Information	Tag-Free

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time