Comparison

Recombinant Human Selenide, water dikinase 1(SEPHS1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP021015HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Selenium donor protein 1
Selenophosphate synthase 1
AA Sequence
STRESFNPESYELDKSFRLTRFTELKGTGCKVPQD VLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTC VIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACAN VLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVM PLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVA TTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAV HQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMAR LNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQ QRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGT CPETSGGLLICLPREQAARFCAEIKSPKYGEGHQA WIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNP TPGATS
Research Topic
Cell Biology
Uniprot ID
P49903
Gene Names
SEPHS1
Tag Info
N-terminal GST-tagged
Expression Region
1-392
MW of Fusion Proten
69, 8
Sequence Info
Full Length
Relevance
Synthesizes selenophosphate from selenide and ATP.
Reference
"Human selenophosphate synthetase 1 has five splice variants with unique interactions, subcellular localizations and expression patterns."
Kim J.Y., Lee K.H., Shim M.S., Shin H., Xu X.M., Carlson B.A., Hatfield D.L., Lee B.J.
Biochem. Biophys. Res. Commun. 397:53-58(2010)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close