Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP021015HU-10 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Cell Biology |
Uniprot ID |
P49903 |
Gene Names |
SEPHS1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
STRESFNPESYELDKSFRLTRFTELKGTGCKVPQD VLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTC VIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACAN VLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVM PLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVA TTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAV HQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMAR LNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQ QRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGT CPETSGGLLICLPREQAARFCAEIKSPKYGEGHQA WIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNP TPGATS |
Expression Region |
1-392 |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
69.8 kDa |
Alternative Name(s) |
Selenium donor protein 1 Selenophosphate synthase 1 |
Relevance |
Synthesizes selenophosphate from selenide and ATP. |
Reference |
"Human selenophosphate synthetase 1 has five splice variants with unique interactions, subcellular localizations and expression patterns." Kim J.Y., Lee K.H., Shim M.S., Shin H., Xu X.M., Carlson B.A., Hatfield D.L., Lee B.J. Biochem. Biophys. Res. Commun. 397:53-58(2010) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Synthesizes selenophosphate from selenide and ATP. |
Subcellular Location |
Isoform 1: Cell membrane, Nucleus membrane, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 4: Cytoplasm |
Protein Families |
Selenophosphate synthase 1 family, Class II subfamily |
Tissue Specificity |
Isoform 1 and isoform 2 are gradually expressed during the cell cycle until G2/M phase and then decreased. Isoform 3 is gradually expressed during the cell cycle until S phase and then decreased. |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.