Recombinant Human Serpin B9(SERPINB9)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP021077HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
P50453
Gene Names
SERPINB9
Organism
Homo sapiens (Human)
AA Sequence
METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSI SSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAF QSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFK ESCLQFYHAELKELSFIRAAEESRKHINTWVSKKT EGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPF DETYTREMPFKINQEEQRPVQMMYQEATFKLAHVG EVRAQLLELPYARKELSLLVLLPDDGVELSTVEKS LTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDM ESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFV HKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFC ADHPFLFFIRHNRANSILFCGRFSSP
Expression Region
1-376aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
69.4 kDa
Alternative Name(s)
Cytoplasmic antiproteinase 3
Relevance
Granzyme B inhibitor.
Reference
"Serine proteinase inhibitor 9 as a tumor antigen recognized by cytotoxic T lymphocytes of epithelial cancer patients."
Tanaka K., Harashima N., Shichijo S., Harada M., Itoh K.
Submitted (APR-2001)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close