Comparison

Recombinant Human Mitochondrial carnitine/acylcarnitine carrier protein(SLC25A20)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP021488HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Carnitine/acylcarnitine translocase
AA Sequence
MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVK VRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITG LYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPE DVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQI QASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLT LMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAP RILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKY PNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPAN AACFLGFEVAMKFLNWATPNL
Research Topic
Signal Transduction
Uniprot ID
O43772
Gene Names
SLC25A20
Tag Info
N-terminal GST-tagged
Expression Region
1-301aa
MW of Fusion Proten
59, 9
Sequence Info
Full Length
Relevance
Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway.
Reference
"The structure and organization of the human carnitine/acylcarnitine translocase (CACT) gene."
Iacobazzi V., Naglieri M.A., Stanley C.A., Wanders R.J.A., Palmieri F.
Biochem. Biophys. Res. Commun. 252:770-774(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close