Recombinant Human Sodium/glucose cotransporter 2(SLC5A2), partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP021679HU1-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Signal Transduction
Target / Protein
SLC5A2
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
P31639
AA Sequence
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLL VIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGAS LFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Tag info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region
1-102aa
Protein length
Partial
MW
15.5 kDa
Alternative Name(s)
Low affinity sodium-glucose cotransporter
Solute carrier family 5 member 2
Relevance
Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1.
Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules
Reference
"Thioglycosides as inhibitors of hSGLT1 and hSGLT2: potential therapeutic agents for the control of hyperglycemia in diabetes."
Castaneda F., Burse A., Boland W., Kinne R.K.
Int J Med Sci 4:131-139(2007)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €178.75
Price: €178.75
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close