Comparison

Recombinant Human Sodium/glucose cotransporter 2(SLC5A2), partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP021679HU1-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Low affinity sodium-glucose cotransporter
Solute carrier family 5 member 2
AA Sequence
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLL VIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGAS LFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Research Topic
Signal Transduction
Uniprot ID
P31639
Gene Names
SLC5A2
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region
1-102aa
MW of Fusion Proten
15, 5
Sequence Info
Partial
Relevance
Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules
Reference
"Thioglycosides as inhibitors of hSGLT1 and hSGLT2: potential therapeutic agents for the control of hyperglycemia in diabetes."
Castaneda F., Burse A., Boland W., Kinne R.K.
Int J Med Sci 4:131-139(2007)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €178.75
Price: €178.75
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close