Comparison

Recombinant Human Synaptosomal-associated protein 29(SNAP29)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP021874HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Soluble 29 kDa NSF attachment protein
Vesicle-membrane fusion protein SNAP-29
AA Sequence
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGP DAPADRQQYLRQEVLRRAEATAASTSRSLALMYES EKVGVASSEELARQRGVLERTEKMVDKMDQDLKIS QKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTS QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDP VPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELS MGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLD VNIKSTERKVRQL
Research Topic
Neuroscience
Uniprot ID
O95721
Gene Names
SNAP29
Tag Info
N-terminal GST-tagged
Expression Region
1-258aa
MW of Fusion Proten
56
Sequence Info
Full Length
Relevance
SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions.
Reference
"Three novel proteins of the syntaxin/SNAP-25 family."
Steegmaier M., Yang B., Yoo J.-S., Huang B., Shen M., Yu S., Luo Y., Scheller R.H.
J. Biol. Chem. 273:34171-34179(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close