Recombinant Human Suppressor of cytokine signaling 2(SOCS2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP022389HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
O14508
Gene Names
SOCS2
Organism
Homo sapiens (Human)
AA Sequence
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAAR LAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTF LIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFR LDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGP EAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCT GAIWGLPLPTRLKDYLEEYKFQV
Expression Region
1-198aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
49.2 kDa
Alternative Name(s)
Cytokine-inducible SH2 protein 2
Relevance
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Reference
"Radiation hybrid and cytogenetic mapping of SOCS1 and SOCS2 to chromosomes 16p13 and 12q, respectively."
Yandava C.N., Pillari A., Drazen J.M.
Genomics 61:108-111(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €186.25
Price: €186.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close