Comparison

Recombinant Human L-lactate dehydrogenase B chain(LDHB)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP013574h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
LDH heart subunit ; LDH-HRenal carcinoma antigen NY-REN-46
AA Sequence
ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMAC AISILGKSLADELALVDVLEDKLKGEMMDLQHGSL FLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGES RLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPV DILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMA EKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVS LQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLK GYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGM YGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQ LKKSADTLWDIQKDLKDL
Research Topic
Metabolism
Uniprot ID
P07195
Gene Names
LDHB
Tag Info
N-terminal 6xHis-tagged
Expression Region
2-334aa
MW of Fusion Proten
40, 5
Sequence Info
Full Length
Reference
Antigens recognized by autologous antibody in patients with renal-cell carcinoma.Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J.3.0.CO; 2-5>Int. J. Cancer 83:456-464(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close