Recombinant Human Prefoldin subunit 5(PFDN5)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
Item no. CSB-RP014144h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q99471
Gene Names
PFDN5
Organism
Homo sapiens (Human)
AA Sequence
AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQL KVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMY VPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRK IDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQ LTALGAAQATAKA
Expression Region
2-154aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
MW
44.2 kDa
Alternative Name(s)
C-Myc-binding protein Mm-1Myc modulator 1
Relevance
Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC.
Reference
MM-1, a novel c-Myc-associating protein that represses transcriptional activity of c-Myc.Mori K., Maeda Y., Kitaura H., Taira T., Iguchi-Ariga S.M., Ariga H.J. Biol. Chem. 273:29794-29800(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close