Comparison

Recombinant Human Prefoldin subunit 1(PFDN1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP014854h-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
AA Sequence
AAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQ LNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQ SKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVK EAEDNIREMLMARRAQ
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O60925
Gene Names
PFDN1
Tag Info
N-terminal GST-tagged
Expression Region
2-122
MW of Fusion Proten
41, 1
Sequence Info
Full Length
Relevance
Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
Reference
Prefoldin, a chaperone that delivers unfolded proteins to cytosolic chaperonin.Vainberg I.E., Lewis S.A., Rommelaere H., Ampe C., Vandekerckhove J., Klein H.L., Cowan N.J.Cell 93:863-873(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close