Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP014854h-200 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
O60925 |
Gene Names |
PFDN1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
AAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQ LNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQ SKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVK EAEDNIREMLMARRAQ |
Expression Region |
2-122 |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
41.1 kDa |
Relevance |
Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. |
Reference |
Prefoldin, a chaperone that delivers unfolded proteins to cytosolic chaperonin.Vainberg I.E., Lewis S.A., Rommelaere H., Ampe C., Vandekerckhove J., Klein H.L., Cowan N.J.Cell 93:863-873(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. |
Protein Families |
Prefoldin subunit beta family |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.