Comparison

Recombinant Human Cytochrome c1, heme protein, mitochondrial(CYC1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP015154h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Complex III subunit 4Complex III subunit IVCytochrome b-c1 complex subunit 4Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit ; Cytochrome c-1
AA Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQ VCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEV QDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAAN NGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTG VSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGT PATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLM MMALLVPLVYTIKRHKWSVLKSRKLAYRPPK
Research Topic
Transport
Uniprot ID
P08574
Gene Names
CYC1
Tag Info
N-terminal GST-tagged
Expression Region
85-325aa
MW of Fusion Proten
54, 4
Sequence Info
Full Length
Relevance
This is the he-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.
Reference
Nucleotide sequence of a cDNA encoding the precursor to human cytochrome c1.Nishikimi M., Ohta S., Suzuki H., Tanaka T., Kikkawa F., Tanaka M., Kagawa Y., Ozawa T.Nucleic Acids Res. 16:3577-3577(1988)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close