Recombinant Human Cytochrome c1, heme protein, mitochondrial(CYC1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
Item no. CSB-RP015154h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Transport
Uniprot ID
P08574
Gene Names
CYC1
Organism
Homo sapiens (Human)
AA Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQ VCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEV QDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAAN NGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTG VSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGT PATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLM MMALLVPLVYTIKRHKWSVLKSRKLAYRPPK
Expression Region
85-325aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
MW
54.4 kDa
Alternative Name(s)
Complex III subunit 4Complex III subunit IVCytochrome b-c1 complex subunit 4Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit ; Cytochrome c-1
Relevance
This is the he-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.
Reference
Nucleotide sequence of a cDNA encoding the precursor to human cytochrome c1.Nishikimi M., Ohta S., Suzuki H., Tanaka T., Kikkawa F., Tanaka M., Kagawa Y., Ozawa T.Nucleic Acids Res. 16:3577-3577(1988)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close