« Back
Home /
Recombinant Human Cytochrome c1, heme protein, mitochondrial(CYC1)

Recombinant Human Cytochrome c1, heme protein, mitochondrial(CYC1)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	200ug
Host	E.coli
Item no.	CSB-RP015154h-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Transport
Uniprot ID	P08574
Gene Names	CYC1
Organism	Homo sapiens (Human)
AA Sequence	SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQ VCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEV QDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAAN NGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTG VSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGT PATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLM MMALLVPLVYTIKRHKWSVLKSRKLAYRPPK
Expression Region	85-325aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	54.4 kDa
Alternative Name(s)	Complex III subunit 4Complex III subunit IVCytochrome b-c1 complex subunit 4Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit ; Cytochrome c-1
Relevance	This is the he-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.
Reference	Nucleotide sequence of a cDNA encoding the precursor to human cytochrome c1.Nishikimi M., Ohta S., Suzuki H., Tanaka T., Kikkawa F., Tanaka M., Kagawa Y., Ozawa T.Nucleic Acids Res. 16:3577-3577(1988)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.
Involvement in disease	Mitochondrial complex III deficiency, nuclear 6 (MC3DN6)
Subcellular Location	Mitochondrion inner membrane, Single-pass membrane protein, Intermembrane side
Protein Families	Cytochrome c family
Paythway	Cardiacmusclecontraction

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time