Comparison

Recombinant Human Replication protein A 32KDA subunit(RPA2),partial

Manufacturer Cusabio
Category
Type Proteins Recombinant
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP015554h-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P15927
Gene Names
RPA2
Organism
Homo sapiens (Human)
AA Sequence
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQA EKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVE ISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVR QWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKS LVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQ PSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQN QVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQA VDFLSNEGHIYSTVDDDHFKST
Expression Region
1-267aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
55.9 kDa
Alternative Name(s)
Replication factor A protein 2 ; RF-A protein 2Replication protein A 34KDA subunit ; RP-A p34
Relevance
As part of the heterotrimeric replication protein A complex (RPA/RP-A), binds and stabilizes single-stranded DNA intermediates, that form during DNA replication or upon DNA stress. It prevents their reannealing and in parallel, recruits and activates different proteins and complexes involved in DNA metabolism. Thereby, it plays an essential role both in DNA replication and the cellular response to DNA damage. In the cellular response to DNA damage, the RPA complex controls DNA repair and DNA damage checkpoint activation. Through recruitment of ATRIP activates the ATR kinase a master regulator of the DNA damage response. It is required for the recruitment of the DNA double-strand break repair factors RAD51 and RAD52 to chromatin in response to DNA damage. Also recruits to sites of DNA damage proteins like XPA and XPG that are involved in nucleotide excision repair and is required for this mechanism of DNA repair. Plays also a role in base excision repair (BER) probably through interaction with UNG. Through RFWD3 may activate CHEK1 and play a role in replication checkpoint control. Also recruits SMARCAL1/HARP, which is involved in replication fork restart, to sites of DNA damage. May also play a role in telomere maintenance
Reference
The ionizing radiation-induced replication protein A phosphorylation response differs between ataxia telangiectasia and normal human cells.Liu V.F., Weaver D.T.Mol. Cell. Biol. 13:7222-7231(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
As part of the heterotrimeric replication protein A complex (RPA/RP-A), binds and stabilizes single-stranded DNA intermediates, that form during DNA replication or upon DNA stress. It prevents their reannealing and in parallel, recruits and activates different proteins and complexes involved in DNA metabolism. Thereby, it plays an essential role both in DNA replication and the cellular response to DNA damage. In the cellular response to DNA damage, the RPA complex controls DNA repair and DNA damage checkpoint activation. Through recruitment of ATRIP activates the ATR kinase a master regulator of the DNA damage response. It is required for the recruitment of the DNA double-strand break repair factors RAD51 and RAD52 to chromatin in response to DNA damage. Also recruits to sites of DNA damage proteins like XPA and XPG that are involved in nucleotide excision repair and is required for this mechanism of DNA repair. Plays also a role in base excision repair (BER) probably through interaction with UNG. Also recruits SMARCAL1/HARP, which is involved in replication fork restart, to sites of DNA damage. May also play a role in telomere maintenance.
Subcellular Location
Nucleus, Nucleus, PML body
Protein Families
Replication factor A protein 2 family
Paythway
DNArepairpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close