Comparison

Recombinant Human V-type proton ATPase subunit F(ATP6V1F)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP015744h-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
V-ATPase 14 kDa subunitVacuolar proton pump subunit F
AA Sequence
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPN FLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYI AEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSI LRRARGMFTAEDLR
Research Topic
Transport
Uniprot ID
Q16864
Gene Names
ATP6V1F
Tag Info
N-terminal GST-tagged
Expression Region
1-119aa
MW of Fusion Proten
40, 4
Sequence Info
Full Length
Relevance
Subunit of the peripheral V1 complex of vacuolar ATPase essential for assbly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Reference
"Initial characterization of the human central proteome."Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close