Recombinant Human Transcription factor BTF3(BTF3),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
ArtNr CSB-RP017144h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Transcription
Uniprot ID
P20290
Gene Names
BTF3
Organism
Homo sapiens (Human)
AA Sequence
TIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTAT ADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIH FNNPKVQASLAANTFTITGHAETKQLTEMLPSILN QLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDD DEVPDLVENFDEASKNEAN
Expression Region
48-206aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
44.3 kDa
Alternative Name(s)
Nascent polypeptide-associated complex subunit beta ; NAC-betaRNA polymerase B transcription factor 3
Relevance
When associated with NACA, prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they erge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. BTF3 is also a general transcription factor that can form a stable complex with RNA polymerase II. Required for the initiation of transcription.
Reference
Sequencing and expression of complementary DNA for the general transcription factor BTF3.Zheng X.M., Black D., Chambon P., Egly J.-M.Nature 344:556-559(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,246.43
Price: €1,246.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close