Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial(SDHA),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Format Liquid
Amount 1mg
Host E.coli
ArtNr CSB-RP019854h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Transport
Target / Protein
SDHA
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
P31040
AA Sequence
SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAF GLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGN MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPA AVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKG GQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVE YFALDLLMENGECRGVIALCIEDGSIHRIRAKNTV VATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQ DLEFV
Tag info
N-terminal GST-tagged
Expression Region
44-293aa
Protein length
Partial
MW
54.1 kDa
Alternative Name(s)
Flavoprotein subunit of complex II ; Fp
Relevance
Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Can act as a tumor suppressor.
Reference
Compound heterozygous mutations in the flavoprotein gene of the respiratory chain complex II in a patient with Leigh syndrome.Parfait B., Chretien D., Roetig A., Marsac C., Munnich A., Rustin P.Hum. Genet. 106:236-243(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,246.43
Price: €1,246.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close