Comparison

Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial protein(SDHA),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP019874h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Flavoprotein subunit of complex II ; Fp
AA Sequence
SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAF GLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGN MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPA AVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKG GQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVE YFALDLLMENGECRGVIALCIEDGSIHRIRAKNTV VATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQ DLEFV
Research Topic
Transport
Uniprot ID
P31040
Gene Names
SDHA
Tag Info
N-terminal 6xHis-tagged
Expression Region
44-293aa
MW of Fusion Proten
31, 1
Sequence Info
Partial
Relevance
Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Can act as a tumor suppressor.
Reference
The cDNA sequence of the flavoprotein subunit of human heart succinate dehydrogenase.Morris A.A.M., Farnsworth L., Ackrell B.A.C., Turnbull D.M., Birch-MacHin M.A.Biochim. Biophys. Acta 1185:125-128(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close