Comparison

Recombinant Human Membrane-associated phosphatidylinositol transfer protein 1(PITPNM1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP019954h-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Transport
Uniprot ID
O00562
Gene Names
PITPNM1
Organism
Homo sapiens (Human)
AA Sequence
MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSG EGSGVEILANRPYTDGPGGSGQYTHKVYHVGSHIP GWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVE KFSIEIETYYLPDGGQQPNVFNLSGAERRQRILDT IDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDD WARTAAQTGPLMCAYKLCKVEFRYWGMQAKIEQFI HDVGLRRVMLRAHRQAWCWQDEWTELSM
Expression Region
1-238aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
54.5 kDa
Alternative Name
Drosophila retinal degeneration B homologPhosphatidylinositol transfer protein, membrane-associated 1 . PITPnm 1. Pyk2 N-terminal domain-interacting receptor 2 . NIR-2
Relevance
Regulates RHOA activity, and plays a role in cytoskeleton rodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Binds phosphatidyl inositol phosphates (in vitro). May catalyze the transfer of phosphatidylinositol and phosphatidylcholine between mbranes . Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions.4 Publications
Reference
Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Regulates RHOA activity, and plays a role in cytoskeleton remodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Binds phosphatidyl inositol phosphates (in vitro). May catalyze the transfer of phosphatidylinositol and phosphatidylcholine between membranes (By similarity). Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions.
Subcellular Location
Cytoplasm, Golgi apparatus, Golgi stack membrane, Peripheral membrane protein, Endoplasmic reticulum membrane, Peripheral membrane protein, Lipid droplet, Cleavage furrow, Midbody
Protein Families
PtdIns transfer protein family, PI transfer class IIA subfamily
Tissue Specificity
Ubiquitous.
Amount: 1mg
Available: In stock
Listprice: €1,552.27
Price: €1,552.27
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close