Comparison

Recombinant Human Ferritin heavy chain(FTH1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP020844h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Cysteine-rich protein TTG-1LIM domain only protein 1 ; LMO-1T-cell translocation protein 1
AA Sequence
TTASTSQVRQNYHQDSEAAINRQINLELYASYVYL SMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLM KLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALH LEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNE QVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTL GDSDNES
Research Topic
Metabolism
Uniprot ID
P02794
Gene Names
FTH1
Tag Info
N-terminal GST-tagged
Expression Region
2-183aa
MW of Fusion Proten
48, 1
Sequence Info
Full Length
Relevance
May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
Reference
Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close