Comparison

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP1A(FKBP1A),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP023254h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
12 kDa FK506-binding protein ; 12 kDa FKBP ; FKBP-12; Calstabin-1FK506-binding protein 1A ; FKBP-1AImmunophilin FKBP12Rotamase
AA Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKK FDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQ RAKLTISPDYAYGATGHPGIIPPHATLVFDVE
Research Topic
Immunology
Uniprot ID
P62942
Gene Names
FKBP1A
Tag Info
N-terminal GST-tagged
Expression Region
2-103aa
MW of Fusion Proten
38, 2
Sequence Info
Partial
Relevance
Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruites SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Reference
Complementary DNA encoding the human T-cell FK506-binding protein, a peptidylprolyl cis-trans isomerase distinct from cyclophilin.Maki N., Sekiguchi F., Nishimaki J., Miwa K., Hayano T., Takahashi N., Suzuki M.Proc. Natl. Acad. Sci. U.S.A. 87:5440-5443(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close