« Back
Home /
Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP1A(FKBP1A),partial

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP1A(FKBP1A),partial

Manufacturer	Cusabio
Category	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins Neurodegeneration Markers;Research Area Protein Aggregation, Clearance & Misfolding
Type	Proteins Recombinant
Specific against	other
Amount	1mg
Host	E.coli
Item no.	CSB-RP023254h-1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Immunology
Uniprot ID	P62942
Gene Names	FKBP1A
Organism	Homo sapiens (Human)
AA Sequence	GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKK FDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQ RAKLTISPDYAYGATGHPGIIPPHATLVFDVE
Expression Region	2-103aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	38.2 kDa
Alternative Name(s)	12KDA FK506-binding protein ; 12KDA FKBP ; FKBP-12; Calstabin-1FK506-binding protein 1A ; FKBP-1AImmunophilin FKBP12Rotamase
Relevance	Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruites SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Reference	Complementary DNA encoding the human T-cell FK506-binding protein, a peptidylprolyl cis-trans isomerase distinct from cyclophilin.Maki N., Sekiguchi F., Nishimaki J., Miwa K., Hayano T., Takahashi N., Suzuki M.Proc. Natl. Acad. Sci. U.S.A. 87:5440-5443(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Subcellular Location	Cytoplasm, cytosol, Sarcoplasmic reticulum membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families	FKBP-type PPIase family, FKBP1 subfamily

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time