Comparison

Recombinant Human Zinc finger BED domain-containing protein 1(ZBED1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP027154h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Putative Ac-like transposable elementdREF homolog
AA Sequence
MENKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNA EGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKN HPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQP GQDALAVKAGHGYDSKKQQELTAAVLGLICEGLYP ASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPE KYGAVREVILKELAEATWCGISTDMWRSENQNRAY
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O96006
Gene Names
ZBED1
Tag Info
N-terminal GST-tagged
Expression Region
1-210aa
MW of Fusion Proten
50, 8
Sequence Info
Partial
Relevance
Binds to 5'-TGTCG[CT]GA[CT]A-3' DNA elents found in the promoter regions of a number of genes related to cell proliferation. Binds to the histone H1 promoter and stimulates transcription. Was first identified as gene weakly similar to Ac transposable elents, but does not code for any transposase activity.
Reference
Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 5:277-286(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close