Recombinant Human Ribosomal protein S6 kinase beta-2(RPS6KB2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
ArtNr CSB-RP029054h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
Q9UBS0
Gene Names
RPS6KB2
Organism
Homo sapiens (Human)
AA Sequence
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELR AAGLEPVGHYEEVELTETSVNVGPERIGPHCFELL RVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAK IVRNAKDTAHTRAERNILESVKHPFIVELAYAFQT GGKLYLILECLSGGELFTHLEREGIFLEDTACFYL AEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKL
Expression Region
1-210aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
50.2 kDa
Alternative Name(s)
70KDA ribosomal protein S6 kinase 2 ; P70S6K2 ; p70-S6K 2S6 kinase-related kinase ; SRKSerine/threonine-protein kinase 14Bp70 ribosomal S6 kinase beta ; S6K-beta ; p70 S6 kinase beta ; p70 S6K-beta ; p70 S6KB ; p70-beta
Relevance
Phosphorylates specifically ribosomal protein S6.
Reference
Molecular cloning and characterization of a novel p70 S6 kinase, p70 S6 kinase beta containing a proline-rich region.Gout I., Minami T., Hara K., Tsujishita Y., Filonenko V., Waterfield M.D., Yonezawa K.J. Biol. Chem. 273:30061-30064(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,246.43
Price: €1,246.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close