Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP029054h-200 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Signal Transduction |
Uniprot ID |
Q9UBS0 |
Gene Names |
RPS6KB2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELR AAGLEPVGHYEEVELTETSVNVGPERIGPHCFELL RVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAK IVRNAKDTAHTRAERNILESVKHPFIVELAYAFQT GGKLYLILECLSGGELFTHLEREGIFLEDTACFYL AEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKL |
Expression Region |
1-210aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
50.2 kDa |
Alternative Name(s) |
70KDA ribosomal protein S6 kinase 2 ; P70S6K2 ; p70-S6K 2S6 kinase-related kinase ; SRKSerine/threonine-protein kinase 14Bp70 ribosomal S6 kinase beta ; S6K-beta ; p70 S6 kinase beta ; p70 S6K-beta ; p70 S6KB ; p70-beta |
Relevance |
Phosphorylates specifically ribosomal protein S6. |
Reference |
Molecular cloning and characterization of a novel p70 S6 kinase, p70 S6 kinase beta containing a proline-rich region.Gout I., Minami T., Hara K., Tsujishita Y., Filonenko V., Waterfield M.D., Yonezawa K.J. Biol. Chem. 273:30061-30064(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Phosphorylates specifically ribosomal protein S6. |
Subcellular Location |
Cytoplasm, Nucleus |
Protein Families |
Protein kinase superfamily, AGC Ser/Thr protein kinase family, S6 kinase subfamily |
Paythway |
ErbBsignalingpathway |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.