Comparison

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2(NDUFA2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP029854h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Complex I-B8 ; CI-B8NADH-ubiquinone oxidoreductase B8 subunit
AA Sequence
AAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIE KRYVELKKANPDLPILIRECSDVQPKLWARYAFGQ ETNVPLNNFSADQVTRALENVLSGKA
Research Topic
Transport
Uniprot ID
O43678
Gene Names
NDUFA2
Tag Info
N-terminal GST-tagged
Expression Region
4-99aa
MW of Fusion Proten
37, 6
Sequence Info
Partial
Relevance
Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Reference
Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits.Ton C., Hwang D.M., Dempsey A.A., Liew C.-C.Biochem. Biophys. Res. Commun. 241:589-594(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close