Comparison

Recombinant Human Protein arginine N-methyltransferase 1(PRMT1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP030254h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Histone-arginine N-methyltransferase PRMT1 (EC:2.1.1.125)Interferon receptor 1-bound protein 4
AA Sequence
MENFVATLANGMSLQPPLEEVSCGQAESSEKPNAE DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSM FHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVI GIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVE LPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWL APDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY GFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEV DIY
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q99873
Gene Names
PRMT1
Tag Info
N-terminal GST-tagged
Expression Region
1-248aa
MW of Fusion Proten
55, 3
Sequence Info
Partial
Relevance
Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in proteins such as ESR1, histone H2, H3 and H4, PIAS1, HNRNPA1, HNRNPD, NFATC2IP, SUPT5H, TAF15 and EWS. Constitutes the main enzyme that mediates monomethylation and asymmetric dimethylation of histone H4 'Arg-4' (H4R3me1 and H4R3me2a, respectively), a specific tag for epigenetic transcriptional activation. Together with dimethylated PIAS1, represses STAT1 transcriptional activity, in the late phase of interferon gamma (IFN-gamma) signaling. May be involved in the regulation of TAF15 transcriptional activity, act as an activator of estrogen receptor (ER)-mediated transactivation, play a key role in neurite outgrowth and act as a negative regulator of megakaryocytic differentiation, by modulating p38 MAPK pathway. Methylates FOXO1 and retains it in the nucleus increasing its transcriptional activity
Reference
"Complete sequencing and characterization of 21, 243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close