Comparison

Recombinant Human ATP synthase subunit O, mitochondrial(ATP5O)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP031844h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Oligomycin sensitivity conferral protein ; OSCP
AA Sequence
FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQV EKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLN DITAKERFSPLTTNLINLLAENGRLSNTQGVVSAF STMMSVHRGEVPCTVTSASPLEEATLSELKTVLKS FLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSV KTKIQKLGRAMREIV
Research Topic
Metabolism
Uniprot ID
P48047
Gene Names
ATP5O
Tag Info
N-terminal GST-tagged
Expression Region
24-213aa
MW of Fusion Proten
47, 9
Sequence Info
Full Length
Relevance
Mitochondrial mbrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the mbrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extrambraneous catalytic core and F0 - containing the mbrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elents.
Reference
"Complete sequencing and characterization of 21, 243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close