Recombinant Human Actin-related protein 2/3 complex subunit 2(ARPC2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
Item no. CSB-RP033654h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
O15144
Gene Names
ARPC2
Organism
Homo sapiens (Human)
AA Sequence
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTF ADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAH GADELLKRVYGSFLVNPESGYNVSLLYDLENLPAS KDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGEN RAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDV VIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELK DTDAAVGDNIGYITFVLFPRHTNASARDNTINLIH TFRDY
Expression Region
1-250aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
55.5 kDa
Alternative Name(s)
Arp2/3 complex 34KDA subunit ; p34-AR; C
Relevance
Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Ses to contact the mother actin filament.
Reference
The human Arp2/3 complex is composed of evolutionarily conserved subunits and is localized to cellular regions of dynamic actin filament assembly.Welch M.D., Depace A.H., Verma S., Iwamatsu A., Mitchison T.J.J. Cell Biol. 138:375-384(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close