Comparison

Recombinant Human B-cell receptor-associated protein 31(BCAP31),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 1mg
Host E.coli
Item no. CSB-RP034254h-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
6C6-AG tumor-associated antigen; Protein CDMp28
AA Sequence
SLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIF KSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIR KYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIA GFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAE SASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVK LEEENRSLKADLQKLKDELASTKQKLEKAENQVLA MRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDK
Research Topic
Apoptosis
Uniprot ID
P51572
Gene Names
BCAP31
Tag Info
N-terminal GST-tagged
Expression Region
2-243aa
MW of Fusion Proten
54, 5
Sequence Info
Partial
Relevance
Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmbrane proteins. May be involved in CASP8-mediated apoptosis.
Reference
Molecular cloning and characterization of a transmembrane surface antigen in human cells.Li E., Bestagno M., Burrone O.Eur. J. Biochem. 238:631-638(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close