Recombinant Human B-cell receptor-associated protein 31(BCAP31),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Format Liquid
Amount 200ug
Host E.coli
ArtNr CSB-RP034254h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Apoptosis
Target / Protein
BCAP31
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
P51572
AA Sequence
SLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIF KSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIR KYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIA GFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAE SASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVK LEEENRSLKADLQKLKDELASTKQKLEKAENQVLA MRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDK
Tag info
N-terminal GST-tagged
Expression Region
2-243aa
Protein length
Partial
MW
54.5 kDa
Alternative Name(s)
6C6-AG tumor-associated antigen; Protein CDMp28
Relevance
Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmbrane proteins. May be involved in CASP8-mediated apoptosis.
Reference
Molecular cloning and characterization of a transmembrane surface antigen in human cells.Li E., Bestagno M., Burrone O.Eur. J. Biochem. 238:631-638(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close