Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP036344h-200 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Transcription |
Uniprot ID |
Q92610 |
Gene Names |
ZNF592 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSE ENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIV KNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPH NCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQ FSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGC GAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPL PLGSQQEHEQSGQNTVEPHKDPDATRFFGEAL |
Expression Region |
1-242aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
53.2 kDa |
Relevance |
May be involved in transcriptional regulation. |
Reference |
Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.DNA Res. 3:321-329(1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
May be involved in transcriptional regulation. |
Subcellular Location |
Nucleus |
Protein Families |
Krueppel C2H2-type zinc-finger protein family |
Tissue Specificity |
Widely expressed, with highest levels in skeletal muscle. Expressed throughout the central nervous system, including in the cerebellum and cerebellar vermis, with higher expression in the substantia nigra. Widely expressed in fetal tissues. |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.