Comparison

Recombinant Human Zinc finger protein 592(ZNF592) ,partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP036344h-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
AA Sequence
MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSE ENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIV KNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPH NCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQ FSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGC GAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPL PLGSQQEHEQSGQNTVEPHKDPDATRFFGEAL
Research Topic
Transcription
Uniprot ID
Q92610
Gene Names
ZNF592
Tag Info
N-terminal GST-tagged
Expression Region
1-242aa
MW of Fusion Proten
53, 2
Sequence Info
Partial
Relevance
May be involved in transcriptional regulation.
Reference
Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.DNA Res. 3:321-329(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close