Comparison

Recombinant Human Negative elongation factor B(NELFB),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP037654h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Cofactor of BR; CA1
AA Sequence
LGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLP SLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERV SAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPV VMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKR QIWQDNQALFGDEVSPLLKQYILEKESALFSTELS VLHNFFSPSPKTRRQGE
Research Topic
Transcription
Uniprot ID
Q8WX92
Gene Names
NELFB
Tag Info
N-terminal GST-tagged
Expression Region
8-199aa
MW of Fusion Proten
48, 9
Sequence Info
Partial
Relevance
Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex. May be able to induce chromatin unfolding.
Reference
BRCA1-induced large-scale chromatin unfolding and allele-specific effects of cancer-predisposing mutations.Ye Q., Hu Y.-F., Zhong H., Nye A.C., Belmont A.S., Li R.J. Cell Biol. 155:911-921(2001)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close