Recombinant Human Cytochrome b-c1 complex subunit 8(UQCRQ),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
Item no. CSB-RP038554h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Transport
Uniprot ID
O14949
Gene Names
UQCRQ
Organism
Homo sapiens (Human)
AA Sequence
GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIP NVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSK RKNPAAY
Expression Region
2-78aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
36.3 kDa
Alternative Name(s)
Complex III subunit omplex III subunit VIIIUbiquinol-cytochrome c reductase complex 9.5KDA proteinUbiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C
Relevance
This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.
Reference
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close