« Back
Home /
Recombinant Human Cytochrome b-c1 complex subunit 8(UQCRQ),partial

Recombinant Human Cytochrome b-c1 complex subunit 8(UQCRQ),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-RP038554h-200
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Transport
Uniprot ID	O14949
Gene Names	UQCRQ
Organism	Homo sapiens (Human)
AA Sequence	GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIP NVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSK RKNPAAY
Expression Region	2-78aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	36.3 kDa
Alternative Name(s)	Complex III subunit omplex III subunit VIIIUbiquinol-cytochrome c reductase complex 9.5KDA proteinUbiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C
Relevance	This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.
Reference	Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.
Involvement in disease	Mitochondrial complex III deficiency, nuclear 4 (MC3DN4)
Subcellular Location	Mitochondrion inner membrane
Protein Families	UQCRQ/QCR8 family
Paythway	Cardiacmusclecontraction
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time