Comparison

Recombinant Human Histone acetyltransferase MYST2(KAT7),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP038644h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Histone acetyltransferase binding to OR; C1Lysine acetyltransferase 7MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2 ; MYST-2
AA Sequence
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGT SRRSARVTRSSARLSQSSQDSSPVRNLQSFGTEEP AYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETE QVVDFSDRETKNTADHDESPPRTPTGNAPSSESDI DISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRF HESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCP LYHN
Research Topic
Transcription
Uniprot ID
O95251
Gene Names
KAT7
Tag Info
N-terminal GST-tagged
Expression Region
1-214aa
MW of Fusion Proten
50, 8
Sequence Info
Partial
Relevance
Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Through chromatin acetylation it may regulate DNA replication and act as a coactivator of TP53-dependent transcription. Specifically represses AR-mediated transcription.
Reference
DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close